PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_88AF62B60.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GATA
Protein Properties Length: 352aa    MW: 40161.1 Da    PI: 8.2071
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_88AF62B60.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.22e-17274308135
                   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                            C++C + +Tp+WR+gp g+ktLCnaCG++y++ +l
  Traes_5BS_88AF62B60.2 274 CTHCLSHTTPQWRSGPLGPKTLCNACGVRYKSGRL 308
                            *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-4155208IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-4160194IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS501148.629164193IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.543268304IPR000679Zinc finger, GATA-type
SMARTSM004013.4E-16268322IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-13272332No hitNo description
Gene3DG3DSA:3.30.50.102.7E-13273306IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.99E-13273320No hitNo description
PROSITE patternPS003440274299IPR000679Zinc finger, GATA-type
PfamPF003202.8E-15274308IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
FSNLVESIAN NTNPKTSGLS KRERQRGQLF AGPCPPSTES EDSSTEWLSI YLGDCLTNPA  60
SYPVSEEQAS VNPNLPHPSS SNPRRKKRSL ASVIRDSDEE YFLIVEPPLL LDQKHWLAES  120
ELILPKKDKD QELVQKLEQE HGEAYKPYTV QFKQEQAVMR CSICLSNSNQ TPQQWQGGPS  180
GALLCNTCSL RLKAGNGFIK LERCGQQVDE EQDHGRGQDK RKIKKTTYYG DDEEPPQEKR  240
RIKKTSFVDE QGKRRTKKTY VNEEVPLEEP VKRCTHCLSH TTPQWRSGPL GPKTLCNACG  300
VRYKSGRLLP EYRPVNSPTF VSFMHSNSHK KVMQMRKSVE NEHEHEYSHS DM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2517110.0AK251711.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf124o21, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579113.11e-120PREDICTED: GATA transcription factor 2-like
TrEMBLW5FMX20.0W5FMX2_WHEAT; Uncharacterized protein
STRINGBRADI4G01140.11e-120(Brachypodium distachyon)
STRINGMLOC_22000.11e-121(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.17e-35GATA transcription factor 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]